Alfa Cytology/Brain Tumors

Search

Alpha Synuclein TNG (A53T, S87N, N103G) Mutant Pre-formed Fibrils

CAT#: PFF-S010

Inquiry
Overview Specification
Species Human
Tag Tag Free
Expression Systems E.coli
Keywords Preformed fibrils
Synonyms Alpha synuclein protein, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 Protein, Alpha Synuclein TNG
Background Human alpha-synuclein TNG mutant (HuTNG) is a triple mutant containing Ala53 mutated to the equivalent mouse residue Thr53, Ser87 mutated to the equivalent mouse residue Asn87, and Asn103 mutated to the equivalent mouse residue Gly103, effectively making it a human-mouse chimeric protein. A53T or S87N substitutions in human α-syn substantially accelerate fibrilization rates in vitro. Chimeric HuTNG fibrils show enhanced induction of α-syn pathology greater than both HuWT and MsWT fibrils after a single unilateral injection into the dorsal striatum in mice. Therefore, HuTNG is a good construct for inducing robust endogenous α-syn seeding and pathology in wild-type mice.
Description Human Recombinant Alpha Synuclein TNG (A53T, S87N, N103G) Mutant Pre-formed Fibrils
SWISS P37840-1
Amino Acid Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQLGKGEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Protein Length Full length (1 - 140 aa)
Applications WB, SDS PAGE, In vitro assay
Research Areas Alzheimer's Disease, Neurodegeneration, Neuroscience, Parkinson's Disease, Synuclein, Tangles & Tau, Multiple System Atrophy
Concentration Lot/batch specific. See included datasheet.
Nature Recombinant
Storage Buffer 1X PBS pH 7.4
Purity >95%
Purification Ion-exchange Purified
Storage Stored at -80°C
Shipping Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
Notes Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
Online Inquiry