Polyclonal Anti-ATRX Antibody (Validated for ICC-IF)

Product Description	Polyclonal antibody against human ATRX
Alternative Gene Names	JMS, MRX52, RAD54, XH2, XNP
Target Protein	Alpha thalassemia/mental retardation syndrome X-linked
Target Gene	ATRX
Antigen Sequence	EFRAMDAVNKEKNTKEHKVIDAKFETKARKGEKPCALEKKDISKSEAKLSRKQVDSEHMHQNVPTEEQRTNKSTGGEHKKSDRKEEPQYEPANTSE
Verified Species Reactivity	Human
Interspecies Information	Highest antigen sequence identity to the following orthologs: Rat ENSRNOG00000056703 (57%) Mouse ENSMUSG00000031229 (51%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Shipping	Normally shipped at ambient temperature.
Storage	Store at +4℃ for short term storage. Long time storage is recommended at -20℃.