Alfa Cytology/Brain Tumors

Search

Polyclonal Anti-IDH1 Antibody (Validated for IHC, WB, 0.05 mg/ml)

CAT#: ATB-G006

Inquiry
Overview Specification
Unit Size 100 μl, 25 μl
Concentration 0.05 mg/ml
Availability >10 in stock
Recommended Applications IHC, WB
Keywords 100 μl, 25 μl; 0.05 mg/ml; IHC, WB
Product Description Polyclonal antibody against human IDH1
Target Protein Isocitrate dehydrogenase 1 (NADP+), soluble
Target Gene IDH1
Antigen Sequence LAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQA
Verified Species Reactivity Human
Interspecies Information Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000015020 (95%)
Mouse ENSMUSG00000025950 (92%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Shipping Normally shipped at ambient temperature.
Storage Store at +4℃ for short term storage. Long time storage is recommended at -20℃.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
Related Products
Immune Checkpoint Proteins CAR-T Target Proteins Antibodies for Glioma Classification Neuroscience Research ELISA Kits Neural Stem Cell and Progenitor Markers Neural Markers Astrocyte Markers Oligodendrocyte Markers Extraction Kits for Brain Tumors Research In Vitro Diagnostic Proteins Neural Recombinant Proteins Pre-Formed Fibrils Test Kits for Brain Tumors-Related Assays
Online Inquiry

Subscribe to Our Newsletter

Copyright © 2024 Alfa Cytology. All rights reserved.